spacer gif spacer gif spacer gif spacer gif spacer gif
 QUICK SEARCH:   [advanced]


spacer gif
     Home     Help     Feedback     Subscriptions     Archive     Search     Table of Contents    


This Article
Right arrow Full Text (PDF)
Right arrow References
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow reprints & permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Weighardt, F.
Right arrow Articles by Riva, S.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Weighardt, F.
Right arrow Articles by Riva, S.
Social Bookmarking
 Add to CiteULike   Add to Complore   Add to Connotea   Add to Del.icio.us   Add to Digg   Add to Reddit   Add to Technorati   Add to Twitter  
What's this?

Journal of Cell Science, Vol 108, Issue 2 545-555, Copyright © 1995 by Company of Biologists


JOURNAL ARTICLES

Nucleo-cytoplasmic distribution of human hnRNP proteins: a search for the targeting domains in hnRNP A1

F Weighardt, G Biamonti and S Riva
Istituto di Genetica Biochimica ed Evoluzionistica del CNR, Universita degli Studi di Pavia, Italy.

hnRNP A1 (34 kDa) is an RNA binding protein consisting of two tandemly arranged RNA binding domains C-terminally linked to a glycine-rich auxiliary domain (2 x RBD-Gly). A1 belongs to the set of polypeptides that bind nascent hnRNA in the nucleus to form the so called hnRNP complexes. These complexes seem to be involved both in pre-mRNA processing and in the nuclear export of mRNA. In fact A1, along with other hnRNP proteins, is exported from the nucleus probably bound to mRNA and is immediately re-imported. A1 nuclear re-import, which requires active transcription, is not mediated by a canonical nuclear localisation signal (NLS). To identify the determinants of A1 subcellular localisation we developed an expression vector for studying the localisation, in transiently transfected cells, of the different structural motifs of A1 fused to a small reporter protein (chloramphenicol acetyltransferase, CAT; 26 kDa). We demonstrate that a 30 amino acid sequence in the glycine-rich domain (YNDFGNYNNQSSNFGPMKGGNFGGRSSGPY), which bears no resemblance to canonical NLS, is necessary and sufficient to target the protein to the nucleus. Our data suggest that this targeting sequence might act by mediating the interaction of A1 with a NLS-containing nuclear import complex. On the other hand, the nuclear export of A1 requires at least one RNA binding domain in accord with the hypothesis that A1 exits from the nucleus bound to mRNA. We propose a mechanism for the nucleo-cytoplasmic shuttling of A1 that envisages a specific role for the different structural domains and can explain the dependence of nuclear import from active transcription.
Add to CiteULike CiteULike   Add to Complore Complore   Add to Connotea Connotea   Add to Del.icio.us Del.icio.us   Add to Digg Digg   Add to Reddit Reddit   Add to Technorati Technorati   Add to Twitter Twitter    What's this?


This article has been cited by other articles:


Home page
J. Virol.Home page
J.-Y. Lin, S.-R. Shih, M. Pan, C. Li, C.-F. Lue, V. Stollar, and M.-L. Li
hnRNP A1 Interacts with the 5' Untranslated Regions of Enterovirus 71 and Sindbis Virus RNA and Is Required for Viral Replication
J. Virol., June 15, 2009; 83(12): 6106 - 6114.
[Abstract] [Full Text] [PDF]


Home page
Mol. Cell. Biol.Home page
C. Barrandon, F. Bonnet, V. T. Nguyen, V. Labas, and O. Bensaude
The Transcription-Dependent Dissociation of P-TEFb-HEXIM1-7SK RNA Relies upon Formation of hnRNP-7SK RNA Complexes
Mol. Cell. Biol., October 15, 2007; 27(20): 6996 - 7006.
[Abstract] [Full Text] [PDF]


Home page
J. Virol.Home page
C. S. Kim, S. K. Seol, O.-K. Song, J. H. Park, and S. K. Jang
An RNA-Binding Protein, hnRNP A1, and a Scaffold Protein, Septin 6, Facilitate Hepatitis C Virus Replication
J. Virol., April 15, 2007; 81(8): 3852 - 3865.
[Abstract] [Full Text] [PDF]


Home page
Mol. Cell. Biol.Home page
S. Guil, J. C. Long, and J. F. Caceres
hnRNP A1 Relocalization to the Stress Granules Reflects a Role in the Stress Response
Mol. Cell. Biol., August 1, 2006; 26(15): 5744 - 5758.
[Abstract] [Full Text] [PDF]


Home page
Nucleic Acids ResHome page
Y. Ling, A. J. Smith, and G. T. Morgan
A sequence motif conserved in diverse nuclear proteins identifies a protein interaction domain utilised for nuclear targeting by human TFIIS.
Nucleic Acids Res., January 1, 2006; 34(8): 2219 - 2229.
[Abstract] [Full Text] [PDF]


Home page
Proc. Natl. Acad. Sci. USAHome page
E. Allemand, S. Guil, M. Myers, J. Moscat, J. F. Caceres, and A. R. Krainer
Regulation of heterogenous nuclear ribonucleoprotein A1 transport by phosphorylation in cells stressed by osmotic shock
PNAS, March 8, 2005; 102(10): 3605 - 3610.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
G. Maertens, P. Cherepanov, Z. Debyser, Y. Engelborghs, and A. Engelman
Identification and Characterization of a Functional Nuclear Localization Signal in the HIV-1 Integrase Interactor LEDGF/p75
J. Biol. Chem., August 6, 2004; 279(32): 33421 - 33429.
[Abstract] [Full Text] [PDF]


Home page
RNAHome page
C.-Y. A. CHEN, N. XU, W. ZHU, and A.-B. SHYU
Functional dissection of hnRNP D suggests that nuclear import is required before hnRNP D can modulate mRNA turnover in the cytoplasm
RNA, April 1, 2004; 10(4): 669 - 680.
[Abstract] [Full Text] [PDF]


Home page
Proc. Natl. Acad. Sci. USAHome page
S. Guttinger, P. Muhlhausser, R. Koller-Eichhorn, J. Brennecke, and U. Kutay
From The Cover: Transportin2 functions as importin and mediates nuclear import of HuR
PNAS, March 2, 2004; 101(9): 2918 - 2923.
[Abstract] [Full Text] [PDF]


Home page
Mol. Cell. Biol.Home page
A. N. Chkheidze and S. A. Liebhaber
A Novel Set of Nuclear Localization Signals Determine Distributions of the {alpha}CP RNA-Binding Proteins
Mol. Cell. Biol., December 1, 2003; 23(23): 8405 - 8415.
[Abstract] [Full Text] [PDF]


Home page
J. Virol.Home page
S. T. Shi, G.-Y. Yu, and M. M. C. Lai
Multiple Type A/B Heterogeneous Nuclear Ribonucleoproteins (hnRNPs) Can Replace hnRNP A1 in Mouse Hepatitis Virus RNA Synthesis
J. Virol., October 1, 2003; 77(19): 10584 - 10593.
[Abstract] [Full Text] [PDF]


Home page
Nucleic Acids ResHome page
K. Aoki, Y. Ishii, K. Matsumoto, and M. Tsujimoto
Methylation of Xenopus CIRP2 regulates its arginine- and glycine-rich region-mediated nucleocytoplasmic distribution
Nucleic Acids Res., December 1, 2002; 30(23): 5182 - 5192.
[Abstract] [Full Text] [PDF]


Home page
J. Cell Sci.Home page
D Vautier, P Chesne, C Cunha, A Calado, J. Renard, and M Carmo-Fonseca
Transcription-dependent nucleocytoplasmic distribution of hnRNP A1 protein in early mouse embryos
J. Cell Sci., January 4, 2001; 114(8): 1521 - 1531.
[Abstract] [PDF]


Home page
JCBHome page
M. E. Nemergut and I. G. Macara
Nuclear Import of the Ran Exchange Factor, RCC1, Is Mediated by at Least Two Distinct Mechanisms
J. Cell Biol., May 15, 2000; 149(4): 835 - 850.
[Abstract] [Full Text] [PDF]


Home page
Mol. Cell. Biol.Home page
K. Welch, J. Franke, M. Kohler, and I. G. Macara
RanBP3 Contains an Unusual Nuclear Localization Signal That Is Imported Preferentially by Importin-alpha 3
Mol. Cell. Biol., December 1, 1999; 19(12): 8400 - 8411.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
M. Clau{beta}en, F. Rudt, and T. Pieler
Functional Modules in Ribosomal Protein L5 for Ribonucleoprotein Complex Formation and Nucleocytoplasmic Transport
J. Biol. Chem., November 26, 1999; 274(48): 33951 - 33958.
[Abstract] [Full Text] [PDF]


Home page
Mol. Cell. Biol.Home page
J. Bear, W. Tan, A. S. Zolotukhin, C. Tabernero, E. A. Hudson, and B. K. Felber
Identification of Novel Import and Export Signals of Human TAP, the Protein That Binds to the Constitutive Transport Element of the Type D Retrovirus mRNAs
Mol. Cell. Biol., September 1, 1999; 19(9): 6306 - 6317.
[Abstract] [Full Text] [PDF]


Home page
JCBHome page
N. Kataoka, J. L. Bachorik, and G. Dreyfuss
Transportin-SR, a Nuclear Import Receptor for SR Proteins
J. Cell Biol., June 14, 1999; 145(6): 1145 - 1152.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
H. P. Bogerd, R. E. Benson, R. Truant, A. Herold, M. Phingbodhipakkiya, and B. R. Cullen
Definition of a Consensus Transportin-specific Nucleocytoplasmic Transport Signal
J. Biol. Chem., April 2, 1999; 274(14): 9771 - 9777.
[Abstract] [Full Text] [PDF]


Home page
Genes Dev.Home page
A. Norvell, R. L. Kelley, K. Wehr, and T. Schüpbach
Specific isoforms of Squid, a Drosophila hnRNP, perform distinct roles in Gurken localization during oogenesis
Genes & Dev., April 1, 1999; 13(7): 864 - 876.
[Abstract] [Full Text]


Home page
Mol. Cell. Biol.Home page
D. Palmeri and M. H. Malim
Importin beta  Can Mediate the Nuclear Import of an Arginine-Rich Nuclear Localization Signal in the Absence of Importin alpha
Mol. Cell. Biol., February 1, 1999; 19(2): 1218 - 1225.
[Abstract] [Full Text] [PDF]


Home page
J. Cell Sci.Home page
F Weighardt, F Cobianchi, L Cartegni, I Chiodi, A Villa, S Riva, and G Biamonti
A novel hnRNP protein (HAP/SAF-B) enters a subset of hnRNP complexes and relocates in nuclear granules in response to heat shock
J. Cell Sci., January 5, 1999; 112(10): 1465 - 1476.
[Abstract] [PDF]


Home page
JCBHome page
M. Albertini, L. F. Pemberton, J. S. Rosenblum, and G. Blobel
A Novel Nuclear Import Pathway for the Transcription Factor TFIIS
J. Cell Biol., December 14, 1998; 143(6): 1447 - 1455.
[Abstract] [Full Text] [PDF]


Home page
Mol. Cell. Biol.Home page
M. C. Siomi, M. Fromont, J.-C. Rain, L. Wan, F. Wang, P. Legrain, and G. Dreyfuss
Functional Conservation of the Transportin Nuclear Import Pathway in Divergent Organisms
Mol. Cell. Biol., July 1, 1998; 18(7): 4141 - 4148.
[Abstract] [Full Text]


Home page
Mol. Cell. Biol.Home page
R. Truant, R. A. Fridell, R. E. Benson, H. Bogerd, and B. R. Cullen
Identification and Functional Characterization of a Novel Nuclear Localization Signal Present in the Yeast Nab2 Poly(A)+ RNA Binding Protein
Mol. Cell. Biol., March 1, 1998; 18(3): 1449 - 1458.
[Abstract] [Full Text]


Home page
Genes Dev.Home page
J. F. Cáceres, G. R. Screaton, and A. R. Krainer
A specific subset of SR proteins shuttles continuously between the nucleus and the cytoplasm
Genes & Dev., January 1, 1998; 12(1): 55 - 66.
[Abstract] [Full Text]


Home page
JCBHome page
M. C. Siomi, P. S. Eder, N. Kataoka, L. Wan, Q. Liu, and G. Dreyfuss
Transportin-mediated Nuclear Import of Heterogeneous Nuclear RNP Proteins
J. Cell Biol., September 22, 1997; 138(6): 1181 - 1192.
[Abstract] [Full Text] [PDF]


Home page
JCBHome page
J. F. Caceres, T. Misteli, G. R. Screaton, D. L. Spector, and A. R. Krainer
Role of the Modular Domains of SR Proteins in Subnuclear Localization and Alternative Splicing Specificity
J. Cell Biol., July 28, 1997; 138(2): 225 - 238.
[Abstract] [Full Text] [PDF]


Home page
JCBHome page
E. Izaurralde, A. Jarmolowski, C. Beisel, I. W. Mattaj, G. Dreyfuss, and U. Fischer
A Role for the M9 Transport Signal of hnRNP A1 in mRNA Nuclear Export
J. Cell Biol., April 7, 1997; 137(1): 27 - 35.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
D. Mahe, P. Mahl, R. Gattoni, N. Fischer, M.-G. Mattei, J. Stevenin, and J.-P. Fuchs
Cloning of Human 2H9 Heterogeneous Nuclear Ribonucleoproteins. RELATION WITH SPLICING AND EARLY HEAT SHOCK-INDUCED SPLICING ARREST
J. Biol. Chem., January 17, 1997; 272(3): 1827 - 1836.
[Abstract] [Full Text] [PDF]


Home page
J. Cell Sci.Home page
R. Fridell, R Truant, L Thorne, R. Benson, and B. Cullen
Nuclear import of hnRNP A1 is mediated by a novel cellular cofactor related to karyopherin-beta
J. Cell Sci., January 6, 1997; 110(11): 1325 - 1331.
[Abstract] [PDF]


Home page
Genes Dev.Home page
M S Lee, M Henry, and P A Silver
A protein that shuttles between the nucleus and the cytoplasm is an important mediator of RNA export.
Genes & Dev., May 15, 1996; 10(10): 1233 - 1246.
[Abstract] [PDF]


Home page
J. Biol. Chem.Home page
H. Kawamura, Y. Tomozoe, T. Akagi, D. Kamei, M. Ochiai, and M. Yamada
Identification of the Nucleocytoplasmic Shuttling Sequence of Heterogeneous Nuclear Ribonucleoprotein D-like Protein JKTBP and Its Interaction with mRNA
J. Biol. Chem., January 18, 2002; 277(4): 2732 - 2739.
[Abstract] [Full Text] [PDF]




© The Company of Biologists Ltd 1995