|
|
|
||||
| Home Help Feedback Subscriptions Archive Search Table of Contents | |||||
Journal of Cell Science, Vol 108, Issue 2 545-555, Copyright © 1995 by Company of Biologists
JOURNAL ARTICLES |
F Weighardt, G Biamonti and S Riva
Istituto di Genetica Biochimica ed Evoluzionistica del CNR, Universita degli Studi di Pavia, Italy.
hnRNP A1 (34 kDa) is an RNA binding protein consisting of two tandemly arranged RNA binding domains C-terminally linked to a glycine-rich auxiliary domain (2 x RBD-Gly). A1 belongs to the set of polypeptides that bind nascent hnRNA in the nucleus to form the so called hnRNP complexes. These complexes seem to be involved both in pre-mRNA processing and in the nuclear export of mRNA. In fact A1, along with other hnRNP proteins, is exported from the nucleus probably bound to mRNA and is immediately re-imported. A1 nuclear re-import, which requires active transcription, is not mediated by a canonical nuclear localisation signal (NLS). To identify the determinants of A1 subcellular localisation we developed an expression vector for studying the localisation, in transiently transfected cells, of the different structural motifs of A1 fused to a small reporter protein (chloramphenicol acetyltransferase, CAT; 26 kDa). We demonstrate that a 30 amino acid sequence in the glycine-rich domain (YNDFGNYNNQSSNFGPMKGGNFGGRSSGPY), which bears no resemblance to canonical NLS, is necessary and sufficient to target the protein to the nucleus. Our data suggest that this targeting sequence might act by mediating the interaction of A1 with a NLS-containing nuclear import complex. On the other hand, the nuclear export of A1 requires at least one RNA binding domain in accord with the hypothesis that A1 exits from the nucleus bound to mRNA. We propose a mechanism for the nucleo-cytoplasmic shuttling of A1 that envisages a specific role for the different structural domains and can explain the dependence of nuclear import from active transcription.
This article has been cited by other articles:
![]() |
G. S. Pesiridis, V. M.-Y. Lee, and J. Q. Trojanowski Mutations in TDP-43 link glycine-rich domain functions to amyotrophic lateral sclerosis Hum. Mol. Genet., October 15, 2009; 18(R2): R156 - R162. [Abstract] [Full Text] [PDF] |
||||
![]() |
K. Eto, K. Eda, M. Hayano, S. Goto, K. Nagao, T. Kawasaki, H. Kashimura, H. Tarui, O. Nishimura, K. Agata, et al. Reduced Expression of an RNA-binding Protein by Prolactin Leads to Translational Silencing of Programmed Cell Death Protein 4 and Apoptosis in Newt Spermatogonia J. Biol. Chem., August 28, 2009; 284(35): 23260 - 23271. [Abstract] [Full Text] [PDF] |
||||
![]() |
J.-Y. Lin, S.-R. Shih, M. Pan, C. Li, C.-F. Lue, V. Stollar, and M.-L. Li hnRNP A1 Interacts with the 5' Untranslated Regions of Enterovirus 71 and Sindbis Virus RNA and Is Required for Viral Replication J. Virol., June 15, 2009; 83(12): 6106 - 6114. [Abstract] [Full Text] [PDF] |
||||
![]() |
C. Barrandon, F. Bonnet, V. T. Nguyen, V. Labas, and O. Bensaude The Transcription-Dependent Dissociation of P-TEFb-HEXIM1-7SK RNA Relies upon Formation of hnRNP-7SK RNA Complexes Mol. Cell. Biol., October 15, 2007; 27(20): 6996 - 7006. [Abstract] [Full Text] [PDF] |
||||
![]() |
C. S. Kim, S. K. Seol, O.-K. Song, J. H. Park, and S. K. Jang An RNA-Binding Protein, hnRNP A1, and a Scaffold Protein, Septin 6, Facilitate Hepatitis C Virus Replication J. Virol., April 15, 2007; 81(8): 3852 - 3865. [Abstract] [Full Text] [PDF] |
||||
![]() |
S. Guil, J. C. Long, and J. F. Caceres hnRNP A1 Relocalization to the Stress Granules Reflects a Role in the Stress Response Mol. Cell. Biol., August 1, 2006; 26(15): 5744 - 5758. [Abstract] [Full Text] [PDF] |
||||
![]() |
Y. Ling, A. J. Smith, and G. T. Morgan A sequence motif conserved in diverse nuclear proteins identifies a protein interaction domain utilised for nuclear targeting by human TFIIS. Nucleic Acids Res., January 1, 2006; 34(8): 2219 - 2229. [Abstract] [Full Text] [PDF] |
||||
![]() |
E. Allemand, S. Guil, M. Myers, J. Moscat, J. F. Caceres, and A. R. Krainer Regulation of heterogenous nuclear ribonucleoprotein A1 transport by phosphorylation in cells stressed by osmotic shock PNAS, March 8, 2005; 102(10): 3605 - 3610. [Abstract] [Full Text] [PDF] |
||||
![]() |
G. Maertens, P. Cherepanov, Z. Debyser, Y. Engelborghs, and A. Engelman Identification and Characterization of a Functional Nuclear Localization Signal in the HIV-1 Integrase Interactor LEDGF/p75 J. Biol. Chem., August 6, 2004; 279(32): 33421 - 33429. [Abstract] [Full Text] [PDF] |
||||
![]() |
C.-Y. A. CHEN, N. XU, W. ZHU, and A.-B. SHYU Functional dissection of hnRNP D suggests that nuclear import is required before hnRNP D can modulate mRNA turnover in the cytoplasm RNA, April 1, 2004; 10(4): 669 - 680. [Abstract] [Full Text] [PDF] |
||||
![]() |
S. Guttinger, P. Muhlhausser, R. Koller-Eichhorn, J. Brennecke, and U. Kutay From The Cover: Transportin2 functions as importin and mediates nuclear import of HuR PNAS, March 2, 2004; 101(9): 2918 - 2923. [Abstract] [Full Text] [PDF] |
||||
![]() |
A. N. Chkheidze and S. A. Liebhaber A Novel Set of Nuclear Localization Signals Determine Distributions of the {alpha}CP RNA-Binding Proteins Mol. Cell. Biol., December 1, 2003; 23(23): 8405 - 8415. [Abstract] [Full Text] [PDF] |
||||
![]() |
S. T. Shi, G.-Y. Yu, and M. M. C. Lai Multiple Type A/B Heterogeneous Nuclear Ribonucleoproteins (hnRNPs) Can Replace hnRNP A1 in Mouse Hepatitis Virus RNA Synthesis J. Virol., October 1, 2003; 77(19): 10584 - 10593. [Abstract] [Full Text] [PDF] |
||||
![]() |
K. Aoki, Y. Ishii, K. Matsumoto, and M. Tsujimoto Methylation of Xenopus CIRP2 regulates its arginine- and glycine-rich region-mediated nucleocytoplasmic distribution Nucleic Acids Res., December 1, 2002; 30(23): 5182 - 5192. [Abstract] [Full Text] [PDF] |
||||
![]() |
D Vautier, P Chesne, C Cunha, A Calado, J. Renard, and M Carmo-Fonseca Transcription-dependent nucleocytoplasmic distribution of hnRNP A1 protein in early mouse embryos J. Cell Sci., January 4, 2001; 114(8): 1521 - 1531. [Abstract] [PDF] |
||||
![]() |
M. E. Nemergut and I. G. Macara Nuclear Import of the Ran Exchange Factor, Rcc1, Is Mediated by at Least Two Distinct Mechanisms J. Cell Biol., May 15, 2000; 149(4): 835 - 850. [Abstract] [Full Text] [PDF] |
||||
![]() |
K. Welch, J. Franke, M. Kohler, and I. G. Macara RanBP3 Contains an Unusual Nuclear Localization Signal That Is Imported Preferentially by Importin-alpha 3 Mol. Cell. Biol., December 1, 1999; 19(12): 8400 - 8411. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. Clau{beta}en, F. Rudt, and T. Pieler Functional Modules in Ribosomal Protein L5 for Ribonucleoprotein Complex Formation and Nucleocytoplasmic Transport J. Biol. Chem., November 26, 1999; 274(48): 33951 - 33958. [Abstract] [Full Text] [PDF] |
||||
![]() |
J. Bear, W. Tan, A. S. Zolotukhin, C. Tabernero, E. A. Hudson, and B. K. Felber Identification of Novel Import and Export Signals of Human TAP, the Protein That Binds to the Constitutive Transport Element of the Type D Retrovirus mRNAs Mol. Cell. Biol., September 1, 1999; 19(9): 6306 - 6317. [Abstract] [Full Text] [PDF] |
||||
![]() |
N. Kataoka, J. L. Bachorik, and G. Dreyfuss Transportin-SR, a Nuclear Import Receptor for SR Proteins J. Cell Biol., June 14, 1999; 145(6): 1145 - 1152. [Abstract] [Full Text] [PDF] |
||||
![]() |
H. P. Bogerd, R. E. Benson, R. Truant, A. Herold, M. Phingbodhipakkiya, and B. R. Cullen Definition of a Consensus Transportin-specific Nucleocytoplasmic Transport Signal J. Biol. Chem., April 2, 1999; 274(14): 9771 - 9777. [Abstract] [Full Text] [PDF] |
||||
![]() |
A. Norvell, R. L. Kelley, K. Wehr, and T. Schüpbach Specific isoforms of Squid, a Drosophila hnRNP, perform distinct roles in Gurken localization during oogenesis Genes & Dev., April 1, 1999; 13(7): 864 - 876. [Abstract] [Full Text] |
||||
![]() |
D. Palmeri and M. H. Malim Importin beta Can Mediate the Nuclear Import of an Arginine-Rich Nuclear Localization Signal in the Absence of Importin alpha Mol. Cell. Biol., February 1, 1999; 19(2): 1218 - 1225. [Abstract] [Full Text] [PDF] |
||||
![]() |
F Weighardt, F Cobianchi, L Cartegni, I Chiodi, A Villa, S Riva, and G Biamonti A novel hnRNP protein (HAP/SAF-B) enters a subset of hnRNP complexes and relocates in nuclear granules in response to heat shock J. Cell Sci., January 5, 1999; 112(10): 1465 - 1476. [Abstract] [PDF] |
||||
![]() |
M. Albertini, L. F. Pemberton, J. S. Rosenblum, and G. Blobel A Novel Nuclear Import Pathway for the Transcription Factor TFIIS J. Cell Biol., December 14, 1998; 143(6): 1447 - 1455. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. C. Siomi, M. Fromont, J.-C. Rain, L. Wan, F. Wang, P. Legrain, and G. Dreyfuss Functional Conservation of the Transportin Nuclear Import Pathway in Divergent Organisms Mol. Cell. Biol., July 1, 1998; 18(7): 4141 - 4148. [Abstract] [Full Text] |
||||
![]() |
R. Truant, R. A. Fridell, R. E. Benson, H. Bogerd, and B. R. Cullen Identification and Functional Characterization of a Novel Nuclear Localization Signal Present in the Yeast Nab2 Poly(A)+ RNA Binding Protein Mol. Cell. Biol., March 1, 1998; 18(3): 1449 - 1458. [Abstract] [Full Text] |
||||
![]() |
J. F. Cáceres, G. R. Screaton, and A. R. Krainer A specific subset of SR proteins shuttles continuously between the nucleus and the cytoplasm Genes & Dev., January 1, 1998; 12(1): 55 - 66. [Abstract] [Full Text] |
||||
![]() |
M. C. Siomi, P. S. Eder, N. Kataoka, L. Wan, Q. Liu, and G. Dreyfuss Transportin-mediated Nuclear Import of Heterogeneous Nuclear RNP Proteins J. Cell Biol., September 22, 1997; 138(6): 1181 - 1192. [Abstract] [Full Text] [PDF] |
||||
![]() |
J. F. Caceres, T. Misteli, G. R. Screaton, D. L. Spector, and A. R. Krainer Role of the Modular Domains of SR Proteins in Subnuclear Localization and Alternative Splicing Specificity J. Cell Biol., July 28, 1997; 138(2): 225 - 238. [Abstract] [Full Text] [PDF] |
||||
![]() |
E. Izaurralde, A. Jarmolowski, C. Beisel, I. W. Mattaj, G. Dreyfuss, and U. Fischer A Role for the M9 Transport Signal of hnRNP A1 in mRNA Nuclear Export J. Cell Biol., April 7, 1997; 137(1): 27 - 35. [Abstract] [Full Text] [PDF] |
||||
![]() |
D. Mahe, P. Mahl, R. Gattoni, N. Fischer, M.-G. Mattei, J. Stevenin, and J.-P. Fuchs Cloning of Human 2H9 Heterogeneous Nuclear Ribonucleoproteins. RELATION WITH SPLICING AND EARLY HEAT SHOCK-INDUCED SPLICING ARREST J. Biol. Chem., January 17, 1997; 272(3): 1827 - 1836. [Abstract] [Full Text] [PDF] |
||||
![]() |
R. Fridell, R Truant, L Thorne, R. Benson, and B. Cullen Nuclear import of hnRNP A1 is mediated by a novel cellular cofactor related to karyopherin-beta J. Cell Sci., January 6, 1997; 110(11): 1325 - 1331. [Abstract] [PDF] |
||||
![]() |
M S Lee, M Henry, and P A Silver A protein that shuttles between the nucleus and the cytoplasm is an important mediator of RNA export. Genes & Dev., May 15, 1996; 10(10): 1233 - 1246. [Abstract] [PDF] |
||||
![]() |
H. Kawamura, Y. Tomozoe, T. Akagi, D. Kamei, M. Ochiai, and M. Yamada Identification of the Nucleocytoplasmic Shuttling Sequence of Heterogeneous Nuclear Ribonucleoprotein D-like Protein JKTBP and Its Interaction with mRNA J. Biol. Chem., January 18, 2002; 277(4): 2732 - 2739. [Abstract] [Full Text] [PDF] |
||||