Table 2.

Paxillin peptides that contain more than one phosphorylated residue

Site Position Homologs/other family members Peptides
31Y/40Y 28–42 Chicken ETPYSYPTGNHTYQE
Human ETPYSYPTGNHTYQE
Mouse EPPYSYPTGNHTYQE
Hic-5 ERP------------
31Y/40Y/74S 21-75 Chicken RPVFLTEETPYSYPTGNHTYQEIAVPPPVPPPPSSEALNGTVIDPLDQWQPSVSR
Human RPVFLSEETPYSYPTGNHTYQEIAVPPPVPPPPSSEALNGTILDPLDQWQPSGSR
Mouse RPVFLSEEPPYSYPTGNHTYQEIAVPPPVPPPPSSEALNGTVLDPLDQWQPSGSR
Hic-5 --LGAPKERP---------------PETLTPPPP---------------------
83S/85S/88Y/89S 76–93 Chicken YGHQQPQSQSPIYSSSAK and YGHQQPQSQSPIYSSSAK
Human FIHQQPQSSSPVYGSSAK and FIHQQPQSSSPVYGSSAK
Mouse YAHQQPPSPLPVYSSSAK and YAHQQPPSPLPVYSSSAK
Hic-5 YGHQ-------------- and YGHQ--------------
98S/106S/108S 94–110 Chicken SSSASVPRDGLSSPSPR
Human TSSASNPQDSVGSPCSR
Mouse NSSASNTQDGVGSLCSR
Hic-5 ------PQTGSGESSGT
118Y/119S 111–123 Chicken ASEEEHVYSFPNK
Human VGEEEHVYSFPNK
Mouse AGEEEHVYSFPNK
Hic-5 TGDKDHLYSTVCK
126S/130S/137S 124–147 Chicken QKSAEPSPTMTSTSLGSNLSELDR
Human QKSAEPSPTVMSTSLGSNLSELDR
Mouse QKSAEPSPTVMSSSLGSNLSELDR
Hic-5 PRSPKPVAPVSSSSGVLGNGLCEL
171S/187S-190S 171–194 Chicken [SPS]LPNVTGPHYVIPE[SSSS]AGGK
173S/187S-190S 171–194 Chicken [SPS]LPNVTGPHYVIPE[SSSS]AGGK
171S/182Y Human SPP LPGALSPLYGVPE TNSP LGGK
173S/182Y Mouse SPP LPGALSPLYGIPE NNTP LGGK
Hic-5 --Q FPS--SKMAEGEE KEDQ SEDK
228S/231S/245S 210–248 Chicken GIEDVRPSVESLLDELESSVPSPVPAITVSQGEVSSPQR
Human GLEDVRPSVESLLDELESSVPSPVPAITVNQGEMSSPQR
Mouse GLEDVRPSVESLLDELESSVPSPVPAITVNQGEMSSPQR
Hic-5 -------------------PPSPFPA-------------
290S/295T/308S 285–315 Chicken AGGSSSPPSTTPKPGSQLDTMLGSLQSDLNK
Human TG-SSSPPGGPPKPGSQLDSMLGSLQSDLNK
Mouse TG-SSSPPGGLSKPGSQLDSMLGSLQSDLNK
Hic-5 EG-CPSPPGQTSK-GS-LDTMLGLLQSDLSR
  • Selected examples of multiply phosphorylated paxillin peptides and alignment with paxillin homologs and other family members (hic-5) are shown. Not all occurrences of multiply phosphorylated examples are shown. Observed phosphorylation sites in chicken paxillin are shown in red. The corresponding sites in paxillin homologs and hic-5 are also shown in red although these sites were not observed in this study. Red brackets indicate ambiguity in specific phosphorylation site assignments. An observed GlcNAc site in chicken paxillin and the corresponding site in paxillin homologs are shown in green.